McDonnell Genome Institute

Washington University

CircRNA

chr15|98891324|98913282|+|IGF1R|ENST00000268035.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9248

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

TNASVCPSTCGK

Amino Acids from 5' Exons

CAQARVGSGRAPRTMSAATPSAWAAAARLTTTRPVLAATTTMPVSVCLPARPTPTGLRAGAVWTVTSAPTSSAPRAATPRGLSTTASACRSAPRASSATAAR,VPKHVWEAGVHREQVLPPRVPGQLQRAQRHGLCSLPPLLLCRCLCACLPAQHLQVGLALCGPLLRQHPQRREQRLRGVCDPRRRVHAGVPLGLHPQRQPE,CPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQ

Amino Acids from 3' Exons

TLECHRVWAGCLRLQQLEHGGRGPPAQQGRGARHLTTWAEALDSVRRLRQGCDPHHGGERPYPWGQEDLVHSHQCF,PFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNAS,PLRMSQSMMGRMPAAPTAGTWWTWTSRPTRTWSPASYYMGSPGLSTPFTSRLPSPWWRTTISVGPRVRSCTFAPMLQ