McDonnell Genome Institute

Washington University

CircRNA

chr15|96334075|96334603|+|NR2F2|ENST00000394166.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9441

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

GALSHVALR

Amino Acids from 5' Exons

RCRGAGCRRPSRPTGSSRPTGIPSTATRTCPDIFPCCCARSPIPRRASAANACSPTTSWVSRTFANWPRGCSSAPSSGPGTSPSSPTCRSRTRWPCFASPGASCLCMRRSAPCPSTSPRSWPPPACMLRPCPPTGWSPLWTTYGSSKSKWRSSRRCTLTQPSTAASRPSCSPQ,GAEGQDAADPADPRAVRADQRGSPQLPLVPVRIYFPAVARGALSHVALRQPMHAAQQHHGYREHLRTGREDALQRRRVGPEHPLLPRPADHGPGGPASPHLERAVCVECGAVLHAPPRRPAPGRRRPACFAHVRRPGGRLYGPHTDLPRASGEAQGAARLSRVQLPQGHSPVHL,VQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTS

Amino Acids from 3' Exons

RCRGAGCRRPSRPTGSSRPTGIPSTATRTCPDIFPCCCARSPIPRRASAANACSPTTSWVSRTFANWPRGCSSAPSSGPGTSPSSPTCRSRTRWPCFASPGASCLCMRRSAPCPSTSPRSWPPPACMLRPCPPTGWSPLWTTYGSSKSKWRSSRRCTLTQPSTAASRPSCSPQ,GAEGQDAADPADPRAVRADQRGSPQLPLVPVRIYFPAVARGALSHVALRQPMHAAQQHHGYREHLRTGREDALQRRRVGPEHPLLPRPADHGPGGPASPHLERAVCVECGAVLHAPPRRPAPGRRRPACFAHVRRPGGRLYGPHTDLPRASGEAQGAARLSRVQLPQGHSPVHL,VQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTS