McDonnell Genome Institute

Washington University

CircRNA

chr15|92924320|92992998|+|CHD2|ENST00000394196.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9503

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

ENASEVTQPLK

Amino Acids from 5' Exons

SLSLRSFGFRLRQSVGKAGKSRKWTWQRVEQQLIFESVGIERISRFQIPASPPRSQREASLEGTDSCEE,HSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKK,TQPLKKLRVQTQAVSRKVSREVIQEVDMAASRTAALNLLRVSRNLRANQQVPNPSQSSQKPKRSQPLRRNGLMR

Amino Acids from 3' Exons

AGVHSTCAGRVGGRSEAPGTDPQQLCVSNAGIRRAAERKCQR,LECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEEQLKENASE,WSAHVMLSWISRWQISAWVNSTTAVCQQCRNTKSSKKMPAR