McDonnell Genome Institute

Washington University

CircRNA

chr15|90980241|90984140|-|PRC1|ENST00000361188.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9899

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

14

Peptide

LLPLSVLELLDMMIAEEESLK

Amino Acids from 5' Exons

LQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCA,CNKWIGWKNKCKTRKLRQFEWSWFSTGTSAFIARSRDKLLPLSVL,AIRSGSVGRTENAKHEESDGNSSGAGSVLGPVLLPGAETSFCPFLC

Amino Acids from 3' Exons

ELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQ,NSWILLKRKARKDSSKAYPSVRKSTLCAASYMLSHF,TPGYDDCRGKPEGKTHQKHIRLSERAEHSVQRVTCAIS