McDonnell Genome Institute

Washington University

CircRNA

chr15|90976675|90981981|-|PRC1|ENST00000361188.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9734

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

12

Peptide

MLPKEEGETTILQLEK

Amino Acids from 5' Exons

RKASDPNRFTNRGGNLLKEEKQRAKLQKMLPK,EKLQIQIDLQTEEEIFKKKNNEPSSRKCCP,KSFRSKSIYKPRRKSSKRRKTTSQAPENAAQ

Amino Acids from 3' Exons

EEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETK,KKERRPSCNKKICAPKWNCENRKRRENRNSYFKSKIKNCAKFFVCPTMILTVPQCPAKSTSSGNMQLGKQ,RRRDDHLATRKRFAHPSGIDAKTEKGEKTGTEATSRARSRTVRNSLYAPLYQCLSAQLRRAEPVQATCDNFEGNK