McDonnell Genome Institute

Washington University

CircRNA

chr15|90974584|90981981|-|PRC1|ENST00000361188.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

TGTEATSRAR

Amino Acids from 5' Exons

LEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQER,WKKSRHELNCGNRNIQRHLWMGRNSWSMWQNNGRCIDWRKREPSRK,GRRVEGTNIVGTGTFKGIYGEWAEIHGVCGRTMGDASIGERESQAGK

Amino Acids from 3' Exons

EEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETK,KKERRPSCNKKICAPKWNCENRKRRENRNSYFKSKIKNCAKFFVCPTMILTVPQCPAKSTSSGNMQLGKQ,RRRDDHLATRKRFAHPSGIDAKTEKGEKTGTEATSRARSRTVRNSLYAPLYQCLSAQLRRAEPVQATCDNFEGNK