McDonnell Genome Institute

Washington University

CircRNA

chr15|90809136|90811406|+|BLM|ENST00000355112.7

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9922

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

LLPVVPR

Amino Acids from 5' Exons

NLYLLILRFCFKLMVLLKTNWKNMVRKFQYYRNTLNGHRQ,IFIFSGFASNWCYRQTGKIWCGSDFSITEILMDIA,SLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSP

Amino Acids from 3' Exons

LKTVPQGACPAAEAPEEVPLRSSTRKYPYLPTTLQVKPEMKGRGKRCQPPKGLRGEKLLPVVPRQR,RQFPRDKPVQQQRPRKKCRGARRGNTRIFPLLCKNQKKEEEKDASLPKVEEKNCFQWFQGKG,EDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAK