McDonnell Genome Institute

Washington University

CircRNA

chr15|90803520|90809259|+|BLM|ENST00000355112.7

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9695

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

YSEWTSPGSK

Amino Acids from 5' Exons

GVRVQKSSQVYLEKDLLIHDTMPKDFLKSYLTRFWMKTYISMPMTRRSLMCSEIKPKLYMAI,EECKNPVRYIWKRICLFTTQCRKTFKADTQDFGRLIYQCQPGDRLCDARKSPNCTKWQFK,SKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLK

Amino Acids from 3' Exons

NLYLLILRFCFKLMVLLKTNWKNMVRKFQYYRNTLNGHRQ,IFIFSGFASNWCYRQTGKIWCGSDFSITEILMDIA,SLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSP