McDonnell Genome Institute

Washington University

CircRNA

chr15|90448572|90453292|+|IQGAP1|ENST00000268182.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

4

Peptide

KTVRAFSALANIDLALEQGDALALFR

Amino Acids from 5' Exons

HFLHQISTWLNKEMHWPCSGLCSHQPWGFEDCSNRIATGTSSSVINSRRD,IFCISKYRPGFRTRRCTGLVQGSAVTSPGASRTAATERLVLEAAPETAEET,FSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQ

Amino Acids from 3' Exons

HNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLSSSVTGLTNIEEENCQ,IISPTQSSLSQWRCCHRWPSTGHWNQEMIQCGSNAVQLLVLPILRKKTVR,SHPPRALCRSGDVVIGGPDQQGIGIRRCEYSVEAIEQFSYWSYQYGRKLSE