McDonnell Genome Institute

Washington University

CircRNA

chr15|90441505|90483593|+|IQGAP1|ENST00000268182.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9373

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

NSVHAAVIAINEAIDRR

Amino Acids from 5' Exons

YMLLLLLLMKLLTVEFQPTHLQLKIRMPCLILKSPWHPLTRIYFTRLSRTKQMLKT,TCCCYCYSYPNSSRHICSFEKSECHACKSRALGIHLPGYTLPGAGQNDKCKQ,HAAVIAINEAIDRRIPADTFAALKNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNR

Amino Acids from 3' Exons

IIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKF,LLVTCFIIDTIQPLLLLMPLTSLTCQQEASLPQTNAEIWAPLQKCFSMLLPIRCFWEIMPTASLMNIFPSPTRNS,YWLALLSIHESSHCCSCLHHPVSRRPAYHRPTPKSGLHCKNASACCFQDVSGRCPLKHHISFPVLPEIQ