McDonnell Genome Institute

Washington University

CircRNA

chr15|89595392|89601976|+|TICRR|ENST00000268138.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9327

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

NFVPDQPRR

Amino Acids from 5' Exons

EGSLVLQDRRIPCAVPRCMSQGMRPRSYIQMAVRMWLGRKESKRYLVGEQWINWKTEEEHEVLNLK,RGPSYSSETEDEYHVPFLKDVECRKAECEGPEVTSRWQSGCGWGERNPKDTWENSGIGRQRKNTKKFT,GVPRTPVRQKMNTMCRSLKMLNVARLNVKAQKLHPDGSPDVAGEKGIQKIPSGRTVDKLEDRGRTLRSSKPK

Amino Acids from 3' Exons

VYLYPKDTWKSLQQPRVCDSSEAGWCPSYRFFQLHDTREQITTSFCAFFVKCSISVRQPITAGTSYQISQEEK,YIDSIPKTLGNLYNSLGFVIPQKLAGVLPTDFFSDDSMTQENKSPLLSVPFLSSARRSVSGSPESDELQELRTRSAKKR,ILTLSQRHLEIFTTAGLFLRSWLVSFLQIFSVMTPHKRTNHHFFLCLFCQVLVDQCQAALNLMNCRNFVPDQPRRE