McDonnell Genome Institute

Washington University

CircRNA

chr15|89321735|89333913|-|POLG|ENST00000268124.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

AAAAQPIGHPDALER

Amino Acids from 5' Exons

APRLGRPLWGHPAPSGDCRHHHSPGCGAHMAHRQQCP,HPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNAR,TPTMMRKASMGPSCPKWLPAPSLAGLWSPHGSPPAMP

Amino Acids from 3' Exons

DLGWKAGMVKPISLTGEQRQDVSLSTSSSQKKPSWSPKPGVLTPSVGVPAPTMSRLLWRKVAGATVGPGPVPAPGRWVSSSVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQVLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSA,IWGGRQAWSNPFHQESRDRTCLSPRLPASKRSQAGAQSQVFLPAWGSLHQPAACSGGRWPAPPSGQGRFQLRGAGSPAPSPRPTPATGSGGGSSSSSSSSSSNSSLSSRKCYPRRAGSCGTTHWTSRCSREGCTSKSSGKEGRCLARPRCAAASSTCRSTGSGGSQPCPCPTWSCACRPSTGTTWTSTSASWPRSRACPTWRRPTCCCRPSCPRSPRLGPGRRAGPGTAPRGRPYPWPSPRSGPWCSTWRSAWQRELAPHWRWPYPPRP,FGVEGRHGQTHFTDRRAETGRVSLHVFQPVKEAKLEPKARCSDSQRGGPCTNHEPPALEEGGRRHRRARAGSSSGALGLQLRPRVRPQRRAAAAAAAAAAAAAAATAASAAASAILGGRAAAAQPIGHPDALERAARANLRARRGDAWRGRGAPQRRAPAEARALGAASRALARRGAAPAAPLRGQPGPALPPPGPEAEPALPGGGQLAVAGPAAPEAPGLGLGGGLDPVRPRGGGRTRGHPRGAGPGVRRGGLLGRGNLPHIGGGHIPLGL