McDonnell Genome Institute

Washington University

CircRNA

chr15|89285095|89293997|+|FANCI|ENST00000300027.12

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9462

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

FMWMFTAITILSPMK

Amino Acids from 5' Exons

VHVDVHSHYNSVANETFCLEIMDSLRRCLSQQADVRLMLYE,FMWMFTAITILSPMKLFALRSWIVGDAASKLMFDSCFM,SCGCSQPLQFCRQNFLPDHGFEEMLKPASCSTHAL

Amino Acids from 3' Exons

EVGHSELIYVLQKTLHSKSGSQNNGQQDKSFVHEICVQSSHCSFQ,KNRFEDILSLFMCYKKLSDILNEKAGKAKTKMANKTSDSLLSMKFVSSLLTALF,RIGLRTFAYLCVTKNSLTFLMKKRVKPKLKWPTRQVIVFCPNLCPVFSLLFS