McDonnell Genome Institute

Washington University

CircRNA

chr15|85715787|85717402|+|AKAP13|ENST00000361243.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9347

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

11

Peptide

VNESTESLTDEASQPK

Amino Acids from 5' Exons

PHSPRSVLGPQSSWWMKPLPPQYLPIDDPSRVSRSPKVSPYRTLL,LTAQGASSVRSPPGGNRYHPNICQTIPAECLALQKCLHTEHYW,SQPKERPRSAVLLVDETATTPIFANRRSQQSVSLSKSVSIQNIT

Amino Acids from 3' Exons

SWQEHVKHLEIPVSFNRLTKNQQGQVNRITY,VGNDENMSNTWKFLSHSTDSLNKISKVNESTESLTDE,LAMMRTCQTPGNSCLIQQTHIKSARSMSQQNHLLMR