McDonnell Genome Institute

Washington University

CircRNA

chr15|85710578|85719326|+|AKAP13|ENST00000361243.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9017

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

RIGDVLVNQQPK

Amino Acids from 5' Exons

QPKGSLQAHDTSSLPTVIMRNK,SPKGAFRHMTHHHCPRSLETS,AQREPSGTHIITAHGHYEKQ

Amino Acids from 3' Exons

SCRQSFIMSALSRSVVCTARGWRICFLSSRWKSCSPVWMSSVSIANSSRGFWSGRRSLWWIKVKRTFSSRGGMCLI,VDADRVSSCPHSQDHEWCVQPGDDGGSAFAADGRKAVPLFGADQYPPILPEDSGAEEGVSGGKKELSHQEDRGCACKS,LMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQ