McDonnell Genome Institute

Washington University

CircRNA

chr15|85655416|85708086|+|AKAP13|ENST00000361243.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9079

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

25

2

Peptide

MKPEEEHLACDITGSSSSTDDTASLDR

Amino Acids from 5' Exons

PEEEHLACDITGSSSSTDDTASLDRHSSHGSDVSLSQILKPNRSRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSPFRRHSWGPGKNAASDAEMNHR,QRKSIWPVISPDPVHPPMTRLHWTDILLMAVMCLSPRFSQTGQEIGKALMDSTAMGWELRVEKVRVSLLTQATWRRRRWTVSLKCLQTALSGAPCALFLPSGGTAGGLGKMQPAMQKTTG,RGRAFGLYHRIQFIHRHGFTGPTFFSWQCVSLPDFKAKQVKRSAKPWILQPWDGSGSRKEACPRRRGGGGDGQYHSACKLLCPKELHALSFSLPEAQLGAWEKCSQRCRNEPPE

Amino Acids from 3' Exons

IAVLLSTKAAEKVPPVQRSK,LQCFCPQRLPRKSSLLCKGQNE,CSAFVHKGCRESLASCAKVKMK