McDonnell Genome Institute

Washington University

CircRNA

chr15|82225164|82241403|-|EFTUD1|ENST00000268206.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9873

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

26

Peptide

ISQGNEEYLINLIDSPGHVDFSSEVSTAVR

Amino Acids from 5' Exons

LLNVEVRTLLQLLYLFPKCLQLMLRPCLRISQ,FYEMWKGHCSSYYICFQNVCSCGLASEAK,FMKCGSEDTAPVIIFVSKMFAVDAKALPQNKP

Amino Acids from 3' Exons

VMRSTSITLQDTWTFPQKYQPLFAFVMDASLWMLWKESVH,GVPDQSDRLSRTRGLFLRSINRCSHLWMHHCGRCCGRSLST,NEEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAVEGVCPQ