McDonnell Genome Institute

Washington University

CircRNA

chr15|81305907|81306166|+|IL16|ENST00000302987.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9488

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

WAGLPGR

Amino Acids from 5' Exons

VHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTPEAMPDLNSSTDSAASASAASDVSVES,FTECFQMGWPPRKGLFRRAMRFFPSTASLSRGPRTMMPWPSSAKLESPGKLLSQGSLQRPCPTSTPPLTLQPQPLQPVMFLNL,SQSVSKWAGLPGRDYSEGQGSFHQRQVSQGDHAPCLGHPPPSSRAQASCDCHKEADSRGHARPQLLHLCSLSLCSQCFCRI

Amino Acids from 3' Exons

VHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTPEAMPDLNSSTDSAASASAASDVSVES,FTECFQMGWPPRKGLFRRAMRFFPSTASLSRGPRTMMPWPSSAKLESPGKLLSQGSLQRPCPTSTPPLTLQPQPLQPVMFLNL,SQSVSKWAGLPGRDYSEGQGSFHQRQVSQGDHAPCLGHPPPSSRAQASCDCHKEADSRGHARPQLLHLCSLSLCSQCFCRI