McDonnell Genome Institute

Washington University

CircRNA

chr15|80120327|80122800|+|ZFAND6|ENST00000261749.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9745

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

AVPETEDVQGVQLR

Amino Acids from 5' Exons

VCNGTWLKKLITAKCLCFVPLAVDFMETLVQMACVQYAIKNIFKDRIVVMVEAHL,CATEEHGSRNSQPSAYALFHWLWILWKPSYKWHVFSMLRTSSKTEWNKPT,VQLRNMAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPP

Amino Acids from 3' Exons

PCIKSVTFIRICSIFSIGQYICGQSSTNRRCA,PVSNQSLLSESVASSQLDSTSVDKAVPETEDVQ,LYQISHFYQNLHLLNWTVHLWTKQYLKQKMCR