McDonnell Genome Institute

Washington University

CircRNA

chr15|78990188|79004175|-|RASGRF1|ENST00000394745.3

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.906

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

MTSLELLFASGQNNK

Amino Acids from 5' Exons

GVLRTRMDETGKEKDPLYHENHALQ,EFFGQGWMKLEKNERTPYIMKTTKHFND,SSSDKDGNWKRMKGPLISKPLSTSM

Amino Acids from 3' Exons

VAGAPVCQWPEQAPVRTPQVPARHPQVLLAATSVHHQDIVTEPPAEALPEHPHHHWRQGPGPGRPQLQLQWLHQHVLGHVTLQQGHAGHQQALCVQQLHQQDSRGRYDPEARRPFSAQQA,SLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQ,RWSSCLPVARTISSCTVNPPSPRAPPASSPRRHLCPSPRHRHRAAGGSSPTSPSSLAARPWTWPPSAATPMATPACTRPCHPSARPRWTPASSMCPAASPTRFQMRAIRPLRSPKTLQRSASR