McDonnell Genome Institute

Washington University

CircRNA

chr15|78488646|78497311|+|IREB2|ENST00000258886.12

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

TFTCMIFGLVEK

Amino Acids from 5' Exons

VLTPPARTFTCMIFGLVEKKFIERKNMLYYPCLKHKIK,YPHRQEHLPAYLASRRSSSSRGRTCYTIHVSIKRNR,TDPTGKNIYLHDIWPSREEVHRVEEEHVILSMFKALKDKIE

Amino Acids from 3' Exons

GVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADSLGLSGRETFSLTFPEELSPGITLNIQ,VKLFWPKVMKKYTKIILELALHFSSFQEKMQIPWASPVEKHFLHFLKNCLLELHIY,CESCFGRKLKNTQRSFDWNWHSSTSVPSRRKCRFLGPLRRNIFFNISRTVSWNYIEYT