McDonnell Genome Institute

Washington University

CircRNA

chr15|78003304|78009114|-|TBC1D2B|ENST00000300584.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.972

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

VGGSGPPVPGTRR

Amino Acids from 5' Exons

VDQRVFRDLMSEKLPRLHGHFEQYKVDYTLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPK,WTSGCSETLVRSCLGCMATLNSTKSTTLSSLSTGFWWYLWIVSLVTSSLKYGTLSFMKDQ,GPAGVQRPYEEAASVAWPLTVQSRLHSHHFQLVSGGICGCRHPLNMGLFPLRTK

Amino Acids from 3' Exons

VGGSGPPVPGTRRCFLVSRYHSGSFHASRLLYKDSFRIP,LVAVALLYLEQEDAFWCLVTIVEVFMPRDYYTKTLLGSQ,WWQWPSCTWNKKMLSGVSLPWKFSCLETIIQRLFDP