McDonnell Genome Institute

Washington University

CircRNA

chr15|77178789|77252526|-|PEAK1|ENST00000560626.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

47

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

FSVNIAIFR

Amino Acids from 5' Exons

IDHSKSCCNTGKKLTDESFVMHKKSIVCEVLFLKMSACNTFTEHVWKPGECKNCFKPKSLHQLPPDPEKAPITHGNVKTNANHSNNHRIRNTGNFRPPVAKKPTIAVKPTMIVADGQSICGELSIQEHCENKPVIIGWNRNRAALSQKPLNNNNEDDEGISHVPKPYGNNDSAKKMSDNNNGLTEVLKEIAGLDTAPQIRGNETNSRETFLGRINDCYKRSLERKLPPSCMIGGIKETQGKHVILSGSTEVISNEGGRFCYPEFSSGEESEEDVLFSNMEEEHESWDESDEELLAMEIRMRGQPRFANFRANTLSPVRFFVDKKWNTIPLRNKSLQRICAVDYDDSYDEILNGYEENSVVSYGQGSIQSMVSSDSTSPDSSLTEESRSETASSLSQKICNGGLSPGNPGDSKDMKEIEPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLALRLEEKDGKIAVQTEKEESKASTDVAGQAVTINLVPTEEQAKPYRVVNLEQPLCKPYTVVDVSAAMASEHLEGPVNSPKTKSSSSTPNSPVTSSSLTPGQISAHFQKSSAIRYQEVWTSSTSPRQKIPKVELITSGTGPNVPPRKNCHKSAPTSPTATNISSKTIPVKSPNLSEIKFNSYNNAGMPPFPIIIHDEPTYARSSKNAIKVPIVINPNAYDNLAIYKSFLGTSGELSVKEKTTSVISHTYEEIETESKVPDNTTSKTTDCLQTKGFSNSTEHKRGSVAQKVQEFNNCLNRGQSSPQRSYSSSHSSPAKIQRATQEPVAKIEGTQESQMVGSSSTREKASTVLSQIVASIQPPQSPPETPQSGPKACSVEELYAIPPDADVAKSTPKSTPVRPKSLFTSQPSGEAEAPQTTDSPTTKVQKDPSIKPVTPSPSKLVTSPQSEPPAPFPPPRSTSSPYHAGNLLQRHFTNWTKPTSPTRSTEAESVLHSEGSRRAADAKPKRWISFKSFFRRRKTDEEDDKEKEREKGKLVGLDGTVIHMLPPPPVQRHHWFTEAKGESSEKPAIVFMYRCDPAQGQLSVDQSKARTDQAAVMEKGRAENALLQDSEKKRSHSSPSQIPKKIL,LIILRRAAVTHRGSENQMKVLSCTERKALSVKFYFKCLLVTPLLNMFGNLVNARIALNLKVCTSFPQTLRRHPSPMAMKLMPITVTTTASGTRAISGLLWLKNPLLSPLWQMGKVYVVSLASKNTVRTNLSSGGTETELPVRNHLTIIMKMMKELAMFLSLMAIMIVQRRCQITIMDLKCRRQAWILPLREEMKQTPEKHSWEEMIAINDHWKESFHQVAVGRKLRASMLFVGAQKLVMKGAGSVTQSFPVARRVKRMYFSVTWRRSTRVGMRVMKSCWPWRFAEGNLALPTSEQTHCLLFDSLWTKNGIPSPCETSLCRESVLWTMMTAMMKSMVMRKILWSLMDKEAFRAWCHLTPHHQILLQKNHVLRQPVVYPRRFVMGDYLLVTQEILRTRKLSPIMKVPLVIIRIKIHHRLPKAQKFQRPTKQSLLSDKRKMARLLYKLRRKKVKPLQMLLGKQPTLSPQKSKQNLTELTWNSHCASHILSWMCQQPWPVSTSRALLTAPRQKAHPLLQTLQLHHLHHQDKVPISKNPVQFDTKKYGLLAPVHDKRYLKNLLVELDQMFLQGKTVTNQHLHHPQLQTFPPKPSLLSHLICLKLNLIVITMLVCHLFQLSFMTSQLMLGVPKMLSKFPLLSIQMHMTILSTKVFWEQVENSQRKKPQVAILMKKKQKAKCLITPLAKPLTVFKLKGFQTAQSIKGAQWLRRFKSLTTVSTEVSLHHREAIVPATAPQQRSREPLKSLWPKKALRSLRWWAAAAPERKQAQCFLRLWLQSNPHSLLQKHLNLALKLAVWKSFMPFLQMLMLLRAHLRVRQSGPNLSLHLSLVVRLKHLRPQTVLPPKYRKTHPSQSPPLPPNLAPKVSHQLPFPRHALLLLLTMQVTFCRGISPTGPSQPALPGQQKLNQFCTLKAAGGQLMQNLSAGYHLKASSAVGKQMRRMTKRKSERKGNWWAWMAQSFTCCLLLQFSAITGSQRRKESPVRNQPLSSCTGATLLKASSVWIRARLGQTRQQSWRRVEQRMHYYRTQRRRGVILLHHRFLKRFS,SFLEELLHIGEVKTNRKFCHALKEKHCLSSIFKNVCLHLYTCLETWMQELLTKFAPASPRPEGTHHPWQCENCQSQQPPHQEHGQFPASCGKTHYSCEAHYDSGRWAKYMWAHPRTLEQTCHHRVEPKQSCLESETTQRRNPCSALWQCKEDVRQWTNSVKGDSRLGYCPSDKRKNKLQRNILGKNKLLTIIGKKASTKLHDRWDKGNSGQACYSEWEHRSDRGPVLLPRVFQWRGERGCTFQHGGGARELGERAVGHGDSHERATSLCQLQSKHIVSCSILCGQKMEYHPPAKQVSAENLCCGLQLNPEWLGKFCGLLWTRKHSEHGVILHITRFFFNRRITFDSQFIPEDLWGIISWPRRFGHEGNAQLKSLSGRFITGFQKLNKSSRDPQSSPCSPIRRERWQDCCTNEGRKSLYRCCWASSNHKPCPHRRASKTLPSCEPGTAIVQAIYCRGCVSSHGQAPRGPCQPQDKKLILYSKLSSYIIFIDTRTNKCPFPKIQCNSIPRSMDFHQSTTKDTSRTNYWNWTKCSSKEKLSQISTYITHSYKHFLQNHPCVTFVNILQCWYATFSNYHSRANLCSEFQKCYQSSHCYQSKCIQSSYLQKFSGNKWRTLSEGKNHKCNKPYLRNRNRKQSAHHQNHLSSNRVFKQHRAKGLSGSEGSRVQLSQQRSVFTTEKLFQPQLPSKDPESHSRACGQNRRHSGVSDGGQQQHQRESKHSAFSDCGFNPTPTVSSRNTSIWPSLQCGRALCHSSRCCCEHTEYASPAQISLYISAWGSTSDHRQSYHQSTERPIHKASHPLSLQISDPPKATSSLSPATLYFFSLPCRPFAEAFHQLDQANQPYQVNRSISFALRQQAGSCKTALDIIKLLPPSENRGGQRERARERETGGPGWHSHSHAASSSSSAPSLVHRGERRVQETSHCLHVQVRPCSRPAQCGSEQGDRPGSSHGEGSRECITTGLREEEESFFSITDSKDSQ

Amino Acids from 3' Exons

TLLSSEIKEEARKKGHSSWKDPKHLEIWKECFASCNHLCHQNESASDLN,KHCYLQKLRNERQGRKDIHLGKTQSTLKFGRNVLLAAKTTFVTRMNEVLQII,NIAIFRNGMRGKEERTFILERPKAPNLEGMFCLLKPPLSPEMKCFRFK