McDonnell Genome Institute

Washington University

CircRNA

chr15|76574157|76733384|-|SCAPER|ENST00000303521.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9013

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

15

Peptide

EVNEIAFINTLEAQNK

Amino Acids from 5' Exons

ASAISQRSSKTSTSSRQWLMGKQSVCFGSDPRRDHNTGKR,LQRLAKDLLKQVQVQDSGSWANNKVSALDRTLGEITRILEKE,FSDPKIFNKYKFKTVAHGQTIKCLLWIGPERSLEYWKK

Amino Acids from 3' Exons

VNEIAFINTLEAQNKRHDVLSKLKEYEQRLNELQEERQRRQEEKQARDEAVQ,MKLPLIPLKPRINVMMFYQNRNMNRGLMSYRKSVREDRKKSKHVMKLC,KNCLYKYPSPETSCFIKIEGITEAATGRASEKTGRKASTSCA