McDonnell Genome Institute

Washington University

CircRNA

chr15|76434077|76862533|-|SCAPER|ENST00000324767.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9726

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

LHSSAPIVMTK

Amino Acids from 5' Exons

VYVPDENNTILGRNTNKQVFEGLTTGLLKVSAVVLGCLIANRPDGNCQPATPKIPTQEMKNKPSQGDPFNNRVQDLI,FMFQMKIILFWGEIQINKFLKAQLDFSKSVLWFWAALPIDQMETASQLPQKYQHRKKTNPHKVILLTIEFRTLS,LCSRKYYFGEKYKTSFRLDNWTSQSQCCGFGLPDCQSTRWKLPASYPKNTNTGNEKQTLTRSFQSSSGPYQ

Amino Acids from 3' Exons

ASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDD,LHSSAPIVMTKGELQRRVVQQETLGVFHKAKMMM,FIPALQSQSKENSCRGGSYSKKPNSLECSTRKQR