McDonnell Genome Institute

Washington University

CircRNA

chr15|75617407|75617552|-|SNUPN|ENST00000308588.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9705

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

MTGQGWR

Amino Acids from 5' Exons

QAAGLCEPCQKTGRLDRDGEGRKERRNGHHCQEVTKTLCS,KRLDYVNHARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQ,SGWIMTMPEDWLKMTGQGWRVRKKIRKMMKKWTLTLSRSYQNTMLI

Amino Acids from 3' Exons

QAAGLCEPCQKTGRLDRDGEGRKERRNGHHCQEVTKTLCS,KRLDYVNHARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQ,SGWIMTMPEDWLKMTGQGWRVRKKIRKMMKKWTLTLSRSYQNTMLI