McDonnell Genome Institute

Washington University

CircRNA

chr15|75410133|75413045|-|SIN3A|ENST00000360439.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9799

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

9

Peptide

KICCQSLDNSYQMPTAPCIDTPGVISR

Amino Acids from 5' Exons

KEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSV,KSREMPRKLEETTLQHQSRRCMPRLLVSLKTRKICCQSLDNSYQMPTAP,RAEKCQGSWRKLHSSIDRAGGVCPGCSSLKPGRFVVRVWTIPTRCQQLR

Amino Acids from 3' Exons

HRHPRSDSCVPAIQRPPRSDNGIQHLLAPWLQNGANQHGECDNSWPGSSDSHPWHPATASTTTPTSFPAFSPVSPSSCPASSSAPTCQSQQ,IDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSK,STPQELVVCPSYSKATPIWDSTPSCPLATKLRCKPMTWMQLLARFIRFPPMASSHSLNHHPNILPSLQPSQPQLLPSQLLSPHLPKSA