McDonnell Genome Institute

Washington University

CircRNA

chr15|75384263|75413045|-|SIN3A|ENST00000360439.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9583

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

IALSIDTPGVISR

Amino Acids from 5' Exons

LQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFK,CSISVMRSVCRLTFTWQKIIMGPPEASTHRTQGASWSQRISGKLSSCQMRIAL,AAYREDLCAGDPLPGRKWGHRRPAEHTELKEPPGVNVSAESAANVRELL

Amino Acids from 3' Exons

HRHPRSDSCVPAIQRPPRSDNGIQHLLAPWLQNGANQHGECDNSWPGSSDSHPWHPATASTTTPTSFPAFSPVSPSSCPASSSAPTCQSQQ,IDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSK,STPQELVVCPSYSKATPIWDSTPSCPLATKLRCKPMTWMQLLARFIRFPPMASSHSLNHHPNILPSLQPSQPQLLPSQLLSPHLPKSA