McDonnell Genome Institute

Washington University

CircRNA

chr15|74671454|74671774|-|EDC3|ENST00000315127.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9833

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

LAGDITELK

Amino Acids from 5' Exons

GRHYGVKNSGDTRTWRQPTFWRPSSNRIRPLWCWLPSGHQSEWHRQVCQEASLFQQCPSEYPEDRCEEPGCCRFPAAATVLKELCRQAHGILESVQKFPSSAQL,AGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKSYVDRHMESLSQSKSFRRRHNS,QVTLRSKFWRYQDLETTNILETFIKQNAPLVLAAKWASIRMAQASLSRSQPLPAVPLRISLRGQMRARMLPFPRSSNSAQRAMSTGTWNPVSPKVSVVGTTP

Amino Acids from 3' Exons

GRHYGVKNSGDTRTWRQPTFWRPSSNRIRPLWCWLPSGHQSEWHRQVCQEASLFQQCPSEYPEDRCEEPGCCRFPAAATVLKELCRQAHGILESVQKFPSSAQL,AGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKSYVDRHMESLSQSKSFRRRHNS,QVTLRSKFWRYQDLETTNILETFIKQNAPLVLAAKWASIRMAQASLSRSQPLPAVPLRISLRGQMRARMLPFPRSSNSAQRAMSTGTWNPVSPKVSVVGTTP