McDonnell Genome Institute

Washington University

CircRNA

chr15|74589819|74593236|+|ARID3B|ENST00000346246.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9543

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

23

Peptide

LNLTTSSIGSINMSVDIDGTTYAGTPINR

Amino Acids from 5' Exons

GPPSTESPSWPNRSWTCTCCISWPRREAWWRSSTRRSGGRSPKATCPHPSPAPPSPSGR,DPHQPNPHHGQTDPGPVHAVAGDREGRPGGDHQQEDLEGDHQRPKPAHIHHQRRLHPQDA,TPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRT

Amino Acids from 3' Exons

KTEQRPRLQHTPRVALGALTCLWTSMAPPMQ,RQSRGLGCSTEPDHEHWEHHVCGHRWHHLC,DRAEASAAALNLTTSSIGSINMSVDIDGTTYA