McDonnell Genome Institute

Washington University

CircRNA

chr15|74032571|74033422|+|PML|ENST00000436891.7

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

25

Peptide

SPVIGSEVFLPNSNHVASGAGEAGR

Amino Acids from 5' Exons

PEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGE,PRRQRERPRFRPWGWLKPSLWLWYSQCPGHTPCQCTPSPSKALPME,RGGRESEGPGSGPGAGSPAYGCGTVSARGTPRASVRLLHQRPFLWR

Amino Acids from 3' Exons

DVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAGRE,MSPIQRQPRRGSAARPSAPGRSSRWSLRRGRRQGWLGAPRSSPGPAPPRQSHHPTWMDRLAPGAPSEVRSSCPTATTWPVAPGRQVG,CLQYNDSPEEEVQPDPVPQEGHQDGVGGEGGKVGSELPGAAQAQHLQGSLTTPPGWTAPQEPRHRKGLPAQQQPRGQWRRGGRG