McDonnell Genome Institute

Washington University

CircRNA

chr15|73570149|73587618|-|NPTN|ENST00000345330.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9651

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

IQANTTAYITLSALLK

Amino Acids from 5' Exons

DIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPD,TLSIPLAASSSSTRKITLSTLTCRSRKTLASMNVMPPTPLAPPLLSLSSGCGATWPHSGLSWEFWLKLSSLWSLLCMRRGRGQMRFLT,HCQYLWPLLHHQQGKLHVEHCEPADHGRPWRVMCHQRHWLRLCCHCPQGAEPPGPTLAFLGNSGNYHPCGDHCCVEEEEARGS

Amino Acids from 3' Exons

DQAESGFRRIPLRISLCQRSSKRHHSE,INKPRAEDSGEYHCVYHFVSAPKANATIEVK,SISRELRIQANTTAYITLSALLKQTPPLKK