McDonnell Genome Institute

Washington University

CircRNA

chr15|73116539|73126570|+|NEO1|ENST00000261908.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9359

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

2

Peptide

SQHSNVHSILFSGGAGGYTLS

Amino Acids from 5' Exons

EPAFERSLHFIFWWSRWIHSQLEALLLYTVQHILSLLQKLNGKKMELFTYQMIDASFSRMDLYLSAMWCIPNTINLMKVIISVWPLLRVLELLSVEQRSSQ,SQHSNVHSILFSGGAGGYTLSRLFCYIKLFSIFAFSKNMEKRWNFFKLSIRSTPASPGWIFIYQQCGAFQTQTRLLSVCGHCESWNYYQNSEAHSS,ASIRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTIISRTAKLIVA

Amino Acids from 3' Exons

ILRYQTWYFNSLLPSESLVRMCCHVLLQDFLLQPLNGKMRRHLTQK,SGDIRLGIFETAFSLSQSHWSGCSVAMCCFRTSYSNHMDEKGGTHRK,PEVISDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTIKWMKNEEALDTE