McDonnell Genome Institute

Washington University

CircRNA

chr15|72544819|72563500|+|ARIH1|ENST00000379887.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9865

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

QFWYFDGNLEK

Amino Acids from 5' Exons

VLWKPGEALCVSCNSKKVSNTPDEYKVISTGYALSDLLLELPL,YFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNS,TLMETWRSSLLSVMLIQVKSLEHARIQGHQHRICLVRSATTTLT

Amino Acids from 3' Exons

CNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCGRQF,AIDCSGVLPQIATMLLKSNILMLNLFAANVGANF,QSTVKVVSCPRLPPCCSPISCTCSLQMWAPIL