McDonnell Genome Institute

Washington University

CircRNA

chr15|71854376|71893778|-|MYO9A|ENST00000356056.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9171

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

QGLDTVSAK

Amino Acids from 5' Exons

YDPELSSRQFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDT,MIQSCHLDNLGLNCPVPVKTELFLWKSSTTLKCMDCIQKVFIESLVRLIKSRSFGRVIQ,SRAVISTIWGTVPFDQRPNCSFSSGKAHKLHNAWTVYRRYLSKVWFDNQGASAGSRY

Amino Acids from 3' Exons

CQQRSLKQKSSTPRRTSMETCEVSWARPKR,VSKEALNSKNPQLHKEDEPAWKPVKLAGPGQRE,SAKKPTVKILNSIKKMNQHGNLSLGQAKE