McDonnell Genome Institute

Washington University

CircRNA

chr15|71737731|71765199|+|THSD4|ENST00000355327.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9441

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

EHGEPFNGQMVTEGR

Amino Acids from 5' Exons

GNPSMARWQKAGARRRENRKGGTRRRKTCVGRPLRCSPQNRHRPSQSGIQTDFLPIDRTTWCHQHRSPHGAAGITTGSSLGQQNVPRPVGK,GTLQWPDGDRRQEPGGGRTEREERGEGRLAWGGPDVHLRIGTDLPSQASRQIFSPSTGQLGATSTAAPTAQPGSQLEAAWDNRMFHDLWE,EPFNGQMVTEGRSQEEGEQKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPHRPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGK

Amino Acids from 3' Exons

CSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEKPPSQQSCHLKPCGAKWFSTEWSM,VPSSVGAGRNRGRFVLERMQTPLKCWTPLNVLSWRNPPASNPATSSLAEPNGLAPNGA,FHRVWERDATEGGDLCKECRHLSVGPLMFFPGETPQPAILPPQALRSQMVHRMEH