McDonnell Genome Institute

Washington University

CircRNA

chr15|69421991|69429213|+|KIF23|ENST00000260363.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9572

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

EAGLLFTYGVTGSGK

Amino Acids from 5' Exons

VFFLHMVREVEKLTQLVLQGKEGCFLVVWTSLTVGHFKLND,SSFYIWCDGKWKNSHNDWFSRGRRAASSLFGHDLQYRVISSTI,LLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRY

Amino Acids from 3' Exons

EKEQITISQLSLVDLAGSERTNRTRAEGNRLREA,KKNKSLVSCPWILLEVKELTGPEQKGTDYVKL,KRTNHYKSVVLGRSCWKKNPDQSRREQITS