McDonnell Genome Institute

Washington University

CircRNA

chr15|65737706|65738875|-|DENND4A|ENST00000431932.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LGLMSFQLR

Amino Acids from 5' Exons

VYGAAIQFYEPYSEENLTEKQRLLLGLTSADGKSDSSKTIHTNKCICLLSHWPFFDAFRKFLTFLYRYSISGPHVLPIE,FMVLLFSFMNHTLRRISQKSRDFFWVHQQMGSLIVPKQFILTNASVFFLTGLFLMHSGSFLFCIVIPSLGLMSFQLR,LWCCYSVLTILGESHRKAETSFGFNISRWEVFQNNSYQMHLSSFSLAFFCIQEVSDFSVSLFHLWASCPSNE

Amino Acids from 3' Exons

AFVDILKKIMSHSHYRNLFLYFVYQWVQPLNVGHQIANTLCLYFLLLFLEPQLK,PNLISSRRLVILTTGICSSILFTNGCNHMLAIKQIPSACIFYFCFNWSLSK,LICRYPQEDYESFSLPESVPLFCLPMGATIECWPSNSKYPLPVFSTFVLTGASAEK