McDonnell Genome Institute

Washington University

CircRNA

chr15|65701050|65738875|-|DENND4A|ENST00000431932.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9391

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

HAHLSQTTLSGLICR

Amino Acids from 5' Exons

AVLESTWPSRSRSGYFLWTKVRNVVLGVTQFKRALKKHAHLSQTTLS,LFWKVPGLQEVVVAIFFGQKEMLFEHSSKELRSMHTYHKQLSQ,CFGKYLAFKKSWLFSLDKSKKCCFRSNTVQKSFKEACTLITNNSL

Amino Acids from 3' Exons

AFVDILKKIMSHSHYRNLFLYFVYQWVQPLNVGHQIANTLCLYFLLLFLEPQLK,PNLISSRRLVILTTGICSSILFTNGCNHMLAIKQIPSACIFYFCFNWSLSK,LICRYPQEDYESFSLPESVPLFCLPMGATIECWPSNSKYPLPVFSTFVLTGASAEK