McDonnell Genome Institute

Washington University

CircRNA

chr15|65450998|65487818|-|DPP8|ENST00000300141.10

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9949

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LFMLHPLCWK

Amino Acids from 5' Exons

TKSFTALTWFPGECPFCTYQYITEFFSEGWKAIFT,PNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYDLQ,QIVYCSYMVSWMRMSILHIPVYYVFGLESHMIY

Amino Acids from 3' Exons

LPVVVKFLEFYMKKMMNLRWKLFMLHPLCWKQGGQIHSVILKQ,SQWWNSNSIRKIGGNYSCYIPYVGNKEGRFIPLSN,PSGGKILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKT