McDonnell Genome Institute

Washington University

CircRNA

chr15|64075491|64088851|-|FAM96A|ENST00000300030.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9932

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

LEIYISEGTHSTEEDNLIR

Amino Acids from 5' Exons

LEIYISEGTHSTEED,WKSTFLKEPTQQKKT,GNLHFRNPLNRRR

Amino Acids from 3' Exons

ILELSGTQKSPILKNWKWSRKVVWKFRRMKKNIWLLSGSRQQYLIALWRLLL,FDNYPGPRKAQYFRRTGSGLGKLCGSSGDKRRISGYYQVHANSTSLLFGDSY,LIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLI