McDonnell Genome Institute

Washington University

CircRNA

chr15|63930406|63983754|-|DAPK2|ENST00000261891.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9369

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

8

Peptide

LGLEADMCGQFAIVKK

Amino Acids from 5' Exons

LQKLTTSPWVWRLTC,SRNCELRAPGSGGHV,PEIVNYEPLGLEADM

Amino Acids from 3' Exons

WPVCHREEVPGEEHGAVCSQVHQEAAEPGEPARCEPGGDRAGGEHPAAGAAPQCHHAARRLEPHRRGAHPA,GQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILE,ASLPSRSAGRRARGLSMQPSSSRSGRAGRAGAVAGRRSSGRASCGRCCTTMSSRCTTSMRTAPTWCSSLS