McDonnell Genome Institute

Washington University

CircRNA

chr15|63732923|63734849|-|HERC1|ENST00000443617.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9933

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

18

Peptide

NLGFYTVVIETLSVGATMLLPPLR

Amino Acids from 5' Exons

RMQLDIILTSLQDHTHVASLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYT,ECNWISSQVCKIIPTPPYLAIVHPLMLLTYLLCVLATEICQINLTALRAAIQIPTWLKFRPSEIDFI,NATGYHPDKFARSYPRSLPTWLFTLCCPIFCVYWLRKSVRSTLRHSELPSRYPPGNFDEDPLKKFRILY

Amino Acids from 3' Exons

VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQ,WLKLYQWEQPCCYLHYENGWNYFILFYLKDLIDGKAYLKD,GNNFISGSNHAVTSITRTDGITSFSFTSRTMGKLIRT