McDonnell Genome Institute

Washington University

CircRNA

chr15|63654118|63659936|-|HERC1|ENST00000443617.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9723

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

MLLYQIGGSSEQK

Amino Acids from 5' Exons

ALWSWLMPWQPAASPPGCPHSIGNGQLSNSCALLLHTTVTTKLLCRHLLIWEEILENAPLSNWRLIRT,PSGVGCPGSLLPLLQAVLTASAMGSSATRAHSCCTRPQPNYSADTCYGRRSKMLLYQIGGSSEQ,PLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTTLQTLADMGGDLRKCSFIKLEAHQNR

Amino Acids from 3' Exons

KTGTCWMLMKMKSLVKKNLNYLLDRLVMTGALYQNQFSSLTAIHWEHQQWSQPPTVWKRLCK,RLGHVGCRKANWRRIITCWTAWFKPAHCTRTSSVPQRSTGSISSNGHSHQQYGRDSDAN,DWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPLGASVAMVTATNSMEETLMQI