McDonnell Genome Institute

Washington University

CircRNA

chr15|63644991|63658718|-|HERC1|ENST00000443617.6

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9731

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

MVGAGIK

Amino Acids from 5' Exons

WLSEWLSMCLAHSSRYYTDQCDCRRMVGAGIKLP,GCQSGLVCVWRIPQDTTQTNVTSAEGWWEQESNCQ,AVRVAYVFGAFLKILHRPMLVQKDGGSRNQIA

Amino Acids from 3' Exons

VAMAPKRAPLGERESRQLPQTLMTVWWLGELLLLRFFWPEPWSERCLFSQS,LPWLRRKELLWENNVRRAGSCPSKPSPCGGFKESDCCCSGSSGQNHGHESAVSSLSQ,CHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAAAQVLLARTMVMRALSLLSV