McDonnell Genome Institute

Washington University

CircRNA

chr15|63635960|63651380|-|HERC1|ENST00000443617.6

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9916

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

3

Peptide

SLAGEMVTMVNLAMGTATGSGGPGR

Amino Acids from 5' Exons

ALWPSWLPVVLMGTLWPLKVVRSLAGEMVTMVNLAMGTATGSGGPGRSRPYKEKKWC,LCGDPAGDFLWFWALYGPNKWGLLGRWLWTWPWEQRQAAAAQADRGLTRRRSGA,FVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQ

Amino Acids from 3' Exons

GRGCGKPGITQSKFLTSFLEYQWQISSRRFGKDGEYLAS,EGDAEESLGSPSDPSFSPVSWSISGKYLAGALEKMVNIWQVN,KGMLRKAWDHPVIQVSHQFPGVSVANIQALWKRWISGKLM