McDonnell Genome Institute

Washington University

CircRNA

chr15|63061197|63062645|+|TPM1|ENST00000560975.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

72

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

ALMAAEDK

Amino Acids from 5' Exons

PSPTAGRTIKNNGSDLESINGCRGGTDGSCGFVLQPRHLSASNASWFVWYNDCTFTSPSAIYILPVLSLGPLCSFVFPSMLFGQPKKEPNYRTSKLLDLVTLPSAVARLGGSVPGKPKHFNTFGYFKAALRLDSVFIFSHPSPFSLLLPLACLPPFLPLIENISKCAELEEELKTVTNNLKSLEAQAEKVGQEDGVGERHLLRAAQKRPCQKATLTVDILVKWQYCEVIFGELLDNKFFFLTREFILCGYEASIFKPSAKWISYLVVIPCKTIGKKAENVLQCAIYQRFHYLLRDPHLLAELASSLHEKPVDAAAHLECSFLQYSQKEDRYEEEIKVLSDKLKE,QVRQLEEQLRIMDQTLKALMAAEDKVLMARVVFRFNCNPDIFQLPMPPGSFGITTAPSLHPLLFISCLKCFPLVLYAPLFSLHKCSLGSQKRSQIIALQSCWIWSPCLLLLRGWGAVFLENLNILIPDDLATLRQPFVSRTQFSFFPIPLLFLSSFLWLVSHPFCLSKTLANVPSLKKNKLRTTSHWRLRLRRARRMVWGKGIFELLKRGPARKQHLQTFNGNIVRFLESYITNSFFLENLFYVRDMRHQFNLNQVPSGVILLLSHVKQARKQRMYCSVPFDIRGSITSEILNICWLSWRVLCMRSHEIELQPDIWNALSNYSTRRRKTDMRKRSRSFPTSR,KSDSWKNNEWIRPKHWLQRIRYWLVWFLGLTATQTSFSFQCLLVRLVRLHLHFTLCYLYLALSAFPWSFMLLCFPFINALWAAKKGAKLSHFKVVGFGHPAFCCCEVGGQCSWKTTFYLMIWLLGSPSSLGLSFHFFPSLSFFSPPSFGLSPTLSASDRKHQMCRARRIENCDEQLEVTGGSGEGRPGGWCGGKASFKSCSKEALPESNTYSRHFSKMAILGDFWRVTRQILFFNRIYFMLGIGINLITKCQVDKLSCCYPMNNRQESRECIAVCHLISEVPLPPKRSLTSVGAGEFFAEAMSRLSCSLTSGMLFLITVLAEGRQIGRDQGPFRQAEG

Amino Acids from 3' Exons

AETRAEFAERSVTKLEKSIDDLE,LRLGLSLRRGQLNWRKALMTK,DSGVCGEVSNIGEKHLR