McDonnell Genome Institute

Washington University

CircRNA

chr15|61963834|61984999|-|VPS13C|ENST00000249837.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9289

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

MLSVSLFATK

Amino Acids from 5' Exons

RLYPPEIVTLLISGYLPSMLSVSLFATKRTISPKSRFK,DCILQRHYFQAICQVECFLCHCLQRKEQYRRNQDS,IVSSRDSDIIDFRLFAKLNAFCVIVCNEKNNIAEIKIQ

Amino Acids from 3' Exons

YVAHIMTLKLVSTSVTIRENKNIPEILKIQIIGLGTQVSQRPGAQAL,MLPILPSAPLLREKTRIFQKYKFRLAWALKYLSDQEHKHL,CCPYYDPEVSKHLCYDKRKQEYSRNTKNSDNWPGHSSISATRSTST