McDonnell Genome Institute

Washington University

CircRNA

chr15|59217890|59224823|-|MYO1E|ENST00000288235.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9492

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

10

Peptide

VFDFLVDLIEGASAEQK

Amino Acids from 5' Exons

FLFLHICGTRTGKKSQAGRWIASGEANPNPSTPSTSRPVTPGMRSPRPCTPGSLISW,FSFSCISARDKPGPVERKANKPADGQVGRQIRIHPRDPQRRAGLLHPGCARQGPARPGLFLGR,LAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALHARVFDFLVD

Amino Acids from 3' Exons

LIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDIDDRREFQETL,SSRAPLQSRNTALASPAWTIITTASRAHTRLMTLTTGGSFRKL,HRGRLCRAETQPWHHQHGLLLLPEPLGLIQGHRQAGVSGNS