McDonnell Genome Institute

Washington University

CircRNA

chr15|59178392|59231791|-|MYO1E|ENST00000288235.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

20

Peptide

APESHVKDIILQSNPLLEAFGNAK

Amino Acids from 5' Exons

VCHSDQSHLAFLAGRGEARRPAPAAVGQHGQRPVPAGEESVHQSPRV,YAILTKATWPSWQGEEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPES,MPFPKPPGLLGRERRSKASCTCCSRSTWTATSSSWGGVKCSSKPPS

Amino Acids from 3' Exons

HVKDIILQSNPLLEAFGNAKTVRNNNSSRF,TRTLSCSPTRCWRPSGTPRPSGTTTPAD,REGHYPAVQPAAGGLRERQDRPEQQLQPI